PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00498g00013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 331aa    MW: 35936.9 Da    PI: 8.9015
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00498g00013.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.14.8e-14128172347
                               SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                               +WT+eE++ ++ + ++lG+g+W+ I+rt+ ++Rt+ q+ s+ qky
  Peaxi162Scf00498g00013.1 128 PWTEEEHKNFLIGLEKLGKGDWRGISRTFVTTRTPTQVASHAQKY 172
                               8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.941121177IPR017930Myb domain
SuperFamilySSF466891.05E-17123178IPR009057Homeodomain-like
TIGRFAMsTIGR015579.2E-18124176IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.603.9E-10125171IPR009057Homeodomain-like
SMARTSM007174.1E-8125175IPR001005SANT/Myb domain
PfamPF002491.5E-10128172IPR001005SANT/Myb domain
CDDcd001674.16E-8128173No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MGRKCSHCGY IGHNSRTCNT FKAGAGAGAG ASASASTASF IGGLRLFGVQ LDISSSSNNS  60
SIHLKKSFSL DCLSSTYVSP HSSSPSPSSS LSSSRLSANE SCEKSTSING YLSDGLVGRV  120
EERKKGVPWT EEEHKNFLIG LEKLGKGDWR GISRTFVTTR TPTQVASHAQ KYFLRQSNLN  180
KKKRRSSLFD MAERNNKIHD DAKTTKSKYD DLAYNCLGTT KEACQEITRP SLLDLNSFEE  240
EMPTKDHHQE CENSQVQPEE KIHSVPAIWG HGISHNSHHS SLKKVPVNKS STSSNGAVDL  300
ELTLSAPRNN NVDMNNSSSP AAFLIGPITV T
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1180184KKKRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00565DAPTransfer from AT5G56840Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016491815.11e-114PREDICTED: myb-like protein J
TrEMBLA0A0V0HK381e-105A0A0V0HK38_SOLCH; Putative transcription factor MYB1R1-like
STRINGPGSC0003DMT4000009021e-100(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33852147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.13e-52MYB_related family protein